PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017464-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family BBR-BPC
Protein Properties Length: 297aa    MW: 33625.2 Da    PI: 9.5753
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017464-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind310.55.5e-9512971301
              GAGA_bind   1 mdddgsre.rnkg.yye............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernka 73 
                            md++g ++ r++  y++            ++ ++++  ++ +l+ + +erd++irer+ al+ekk a+ erd a +q d+a+ er++a
  SMil_00017464-RA_Salv   1 MDESGRENrRHRMdYHKvpqwnvmpqyqiKEpNAFQ--MNAKLVMLCNERDDAIRERDRALTEKKLALDERDAAMKQLDAAIMERDDA 86 
                            899999887788756669999999887773346777..999*********************************************** PP

              GAGA_bind  74 lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpke 161
                            l erdn+++al+++e +   ++p  ++ ++g+k ++++ +   +  +++++     +  +alp+++ ++ea  +kk  + +++k++++
  SMil_00017464-RA_Salv  87 LRERDNAIAALQFHESA---VNPLLSGGVRGSKRTNHHPN---SMQSEDCI-----HDHDALPVSHVPHEAPLSKKGTRAKTNKDAQT 163
                            *************9987...8899999******9998777...22223333.....34577887775555444443333333333333 PP

              GAGA_bind 162 kkakkkkkksekskkkvkkesad.erskaekksidl.vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvs 247
                            +  +++        kkvkk ++d +rskae++ +dl ++ ++ +Des++PvPvCsCtG++rqCYkWGnGGWqS+CCtt++S yPLP++
  SMil_00017464-RA_Salv 164 RSGRSP--------KKVKKIGEDlNRSKAEWDAQDLsSMSQIMFDESSMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTSLSLYPLPQM 243
                            332333........446666666699**********88************************************************** PP

              GAGA_bind 248 tkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                            +++r+aR++grKmS+++f++lL +Laa G dls pvDLk++WAkHGtn+++ti+
  SMil_00017464-RA_Salv 244 PNKRHARMGGRKMSGSVFSRLLTRLAAAGQDLSIPVDLKEYWAKHGTNRYITIK 297
                            *****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-1131297IPR010409GAGA-binding transcriptional activator
PfamPF062172.3E-891297IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDESGRENRR HRMDYHKVPQ WNVMPQYQIK EPNAFQMNAK LVMLCNERDD AIRERDRALT  60
EKKLALDERD AAMKQLDAAI MERDDALRER DNAIAALQFH ESAVNPLLSG GVRGSKRTNH  120
HPNSMQSEDC IHDHDALPVS HVPHEAPLSK KGTRAKTNKD AQTRSGRSPK KVKKIGEDLN  180
RSKAEWDAQD LSSMSQIMFD ESSMPVPVCS CTGVPRQCYK WGNGGWQSSC CTTSLSLYPL  240
PQMPNKRHAR MGGRKMSGSV FSRLLTRLAA AGQDLSIPVD LKEYWAKHGT NRYITIK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088551.11e-149PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088550.11e-149PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088549.11e-149PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088547.11e-149PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
SwissprotQ8S8C61e-108BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A068TKY01e-132A0A068TKY0_COFCA; Uncharacterized protein
STRINGSolyc01g110470.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-102basic pentacysteine 4